PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010104136.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 224aa    MW: 24539.7 Da    PI: 5.9809
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010104136.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13e-43461451100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la
  XP_010104136.1  46 PCAACKILRRRCADKCVLAPYFPPTEPSKFTIAHRVFGASNIIKFLQELPESQRSDAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLA 140
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_010104136.1 141 KTQAE 145
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.51145146IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-4346143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MECSTETNTT TTTNSSNMVG SQTPSSSSSP PQTPPPPPTP PVVISPCAAC KILRRRCADK  60
CVLAPYFPPT EPSKFTIAHR VFGASNIIKF LQELPESQRS DAVSSMVYEA SARIRDPVYG  120
CAGAICQLQK QVNELQAQLA KTQAELVNMQ CQQANLVALL CMEMAQSQQG SYHDISPHQH  180
HQQTLDGFNN NITTPLMMTG NQNNNNLSFL DDNNLGSLWE PLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104136.11e-167hypothetical protein L484_014422
SwissprotQ9SK082e-77LBD11_ARATH; LOB domain-containing protein 11
TrEMBLW9SCB71e-167W9SCB7_9R
STRINGGLYMA13G40370.27e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.13e-73LOB domain-containing protein 11